PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 1074aa    MW: 120405 Da    PI: 6.1597
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0132genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.16.9e-23126227199
                  EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                  f+k+lt sd++++g +++p++ ae++       + +++  ++l  +d++ ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +d++s+f 
  Gh_D07G0132 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QELAARDLHENTWTFRHIYRGQPKRHLLTTGWSVFVSNKRLFAGDSVLFIRDEKSQF- 220
                  99*****************************954.4444.38************************************************7766666. PP

                  .EEEEE-S CS
           B3  92 lvvkvfrk 99 
                   +++++r+
  Gh_D07G0132 221 -LLGIRRA 227
                  .9999997 PP

2Auxin_resp124.85.7e-41252334183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  aahaa+++s+F+++YnPras+seFvv+++k++ka++++vs+GmRf+m+fete++  rr++Gt++g+sdldpvrW+nS+Wr+L+
  Gh_D07G0132 252 AAHAAANNSPFTIFYNPRASPSEFVVPLAKYNKAMYTQVSLGMRFRMMFETEECGVRRYMGTITGISDLDPVRWKNSQWRNLQ 334
                  79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.2E-43116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.8E-42118241IPR015300DNA-binding pseudobarrel domain
CDDcd100179.25E-20125226No hitNo description
SMARTSM010195.7E-24126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.294126228IPR003340B3 DNA binding domain
PfamPF023624.7E-21126227IPR003340B3 DNA binding domain
PfamPF065074.9E-36252334IPR010525Auxin response factor
Gene3DG3DSA:1.10.510.102.0E-4493570No hitNo description
PfamPF023091.3E-99441032IPR033389AUX/IAA domain
PROSITE profilePS5174526.1929471040IPR000270PB1 domain
SuperFamilySSF542777.85E-99631025No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1074 aa     Download sequence    Send to blast
MKAPPNGFLA NPAEGERKSI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TDFVPSYPNL PSKLICMLHN VTLHADLETD EVYAQMTLQP VNKYDREALL ASDMGLKQSR  120
QPAEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELAARD LHENTWTFRH  180
IYRGQPKRHL LTTGWSVFVS NKRLFAGDSV LFIRDEKSQF LLGIRRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVVPLA KYNKAMYTQV SLGMRFRMMF  300
ETEECGVRRY MGTITGISDL DPVRWKNSQW RNLQVGWDES TAGERPTRVS IWDIEPVVTP  360
FYICPPPFFR PRFPKQPGMP DNDNDVENAF KRAMPWLGDD FGMKDSPNSI FPGLSLVQWM  420
NMQQNNQFAA AQSGLFPSMV SSNPLHNSLG TDDPSKLLNF QAPVLPASNM QFNKANPNEV  480
NQLSHAPMTW PQQQQLQQLL QTPLNQNPQQ QQSQQQLQQR QSQLQPQSHL QQQPQPPLQQ  540
QQQQQQQQQQ RQQAQPQPQQ QQEQQRQQAQ PQLLQQQFLP AQVNNGIIAS NQMLNQNLHQ  600
PGVYSQVQQQ QQQQQILTSN GQSTQTTLPA NKASYPLTSL AQDTQIQQQV EQQQTQLQQN  660
LSQRSQQQPQ IQQLAQQGLP EQQFQLLQKL QQQQQQQSSQ QLLSPTGSLS QSPVVQQQPM  720
HQQNQPMQQV PLSQSQQTLG SNGFSTSMLM QPQQLVVSPS SFLSRSQQVP SMVVTDPVVE  780
PASTLVQELQ SKPDIRIKHE LLASKGPDQS KYKSTVTDQL EASSSETSYC LDAGTIQHNF  840
SLPTFLEGDV QSHPRNNLPF SANIDGLAPD TLLPRGYDSQ KDLQNLLSNY GSNPRDIDTE  900
LSTAAISPQS FGVPNIPFKT GCSNDVAIND AGVLNGGLWA NQTQRMRTYT KVQKRGSVGR  960
SIDVTRYKGY DELRHDLARM FGIEGQMEDP QSSDWKLVYV DHENDILLVG DDPWEEFVSC  1020
VQSIKILSSL EVQQMSLDGD LGNVPVPNQA CSEIDSGNAW RGHYDDTSAA SFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1751535545388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.76150.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444800.10.0PREDICTED: auxin response factor 19-like isoform X3
TrEMBLA0A0D2TJ130.0A0A0D2TJ13_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19